SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1cs3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cs3A
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily POZ domain 1.38e-30
Family BTB/POZ domain 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cs3A   PDB: 1cs3   SUPERFAMILY: 1cs3A
Sequence length 116
Comment (A:)
Sequence
gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn
sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml
Download sequence
Identical sequences 1cs3A 000072837|e1cs3A1|226.1.1.1|A:1-116 cath|current|1cs3A00/7-122 d1cs3a_ 1cs3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]