SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h9eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h9eA
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily LEM domain 1.27e-24
Family LEM domain 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h9eA   PDB: 1h9e   SUPERFAMILY: 1h9eA
Sequence length 56
Comment (A:)
Sequence
pefledpsvltkdklkselvannvtlpageqrkdvyvqlylqhltarnrpplpagt
Download sequence
Identical sequences 1h9e_A cath|current|1h9eA00/1-56 d1h9ea_ 1h9eA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]