SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h9fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h9fA
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily LEM domain 5.71e-17
Family LEM domain 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h9fA   PDB: 1h9f   SUPERFAMILY: 1h9fA
Sequence length 57
Comment (A:)
Sequence
rqedkddldvteltnedlldqlvkygvnpgpivgttrklyekkllklreqgtesrss
Download sequence
Identical sequences 1h9fA 001032999|e1h9fA1|130.1.1.4|A:1-57 cath|current|1h9fA00/1-57 d1h9fa_ 1h9f_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]