SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i4sA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i4sA
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily RNase III domain-like 7.1e-42
Family RNase III catalytic domain-like 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1i4sA   PDB: 1i4s   SUPERFAMILY: 1i4sA
Sequence length 147
Comment (A:)
Sequence
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr
Download sequence
Identical sequences 1i4s_A 1i4s_B cath|current|1i4sA00/1-147 cath|current|1i4sB00/201-347 d1i4sa_ d1i4sb_ 1i4sA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]