SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ko9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ko9A
Domain Number 1 Region: 136-322
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.54e-48
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000135
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.21e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ko9A   PDB: 1ko9
Sequence length 345
Comment (A:)
Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG
Download sequence
Identical sequences E5KPN1 O15527
NP_002533.1.87134 NP_002533.1.92137 1ko9_A gi|4505495|ref|NP_002533.1| ENSP00000342851 ENSP00000342851 1ko9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]