SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p59A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p59A
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.08e-77
Family Endonuclease III 0.0000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1p59A   PDB: 1p59   SUPERFAMILY: 1p59A
Sequence length 226
Comment (A:)
Sequence
gshmltkqqirycldemakmfpdahcelvhrnpfelliavvlsaqctdalvnkvtkrlfe
kyrtphdyiavpleeleqdirsiglyrnkarniqklcamlidkyngevprdrdelmklpg
vgrktanvvvstafgvpaiavdthvervskrlgfcrwddsvlevektlmkiipkeewsit
hhrmiffgryhckaqspqcpscpllhlcregkkrmrkreekaanqk
Download sequence
Identical sequences 1p59_A 1p59A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]