SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1uebA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1uebA
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.16e-28
Family eIF5a N-terminal domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 65-132
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.35e-26
Family Cold shock DNA-binding domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 128-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.27e-19
Family Cold shock DNA-binding domain-like 0.000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1uebA   PDB: 1ueb
Sequence length 184
Comment (A:)
Sequence
MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKL
EDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPI
KVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEY
VGRA
Download sequence
Identical sequences Q72JL2 Q76G20
gi|55981094|ref|YP_144391.1| 262724.TTC0760 300852.TTHA1125 1uebA ttk003000860.1 ttk003000860.2 gi|46199066|ref|YP_004733.1| WP_011173195.1.52262 WP_011173195.1.85415 YP_144391.1.19876 1ueb_A 1ueb_B 4v6a_AV 4v6a_CV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]