SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vkiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vkiA
Domain Number 1 Region: 19-180
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 5.2e-47
Family YbaK/ProRS associated domain 0.0000000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vkiA   PDB: 1vki   SUPERFAMILY: 1vkiA
Sequence length 181
Comment (A:)
Sequence
mgsdkihhhhhhmtensrktatelfefldglgishttkqhepvftvaesqslrdlipggh
tknlfvkdkkdqyfvltveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtv
fgaindtarqvtfvldsdllenelvnghplsndqtttiaskdlirfleatghaplvlkvs
e
Download sequence
Identical sequences cath|current|1vkiB00/4-169 1vkiA 1vki_A 1vki_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]