SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zarA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zarA
Domain Number 1 Region: 94-277
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.42e-33
Family RIO1-like kinases 0.0000000164
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.37e-22
Family Rio2 serine protein kinase N-terminal domain 0.00000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zarA   PDB: 1zar
Sequence length 282
Comment (A:)
Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVV
QNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVK
FHKVGHTSFKKVKEKRDYGDLHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLME
LIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSV
EVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Download sequence
Identical sequences A0A075WP84 O30245
355581 gi|11500002|ref|NP_071248.1| 1tqi_A 1tqm_A 1tqp_A 1zao_A 1zar_A WP_010879913.1.27515 WP_010879913.1.34637 WP_010879913.1.46508 1zarA 224325.AF2426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]