SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2c7pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c7pA
Domain Number 1 Region: 12-202,233-321
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.64e-130
Family C5 cytosine-specific DNA methylase, DCM 0.000000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c7pA   PDB: 2c7p
Sequence length 327
Comment (A:)
Sequence
MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGD
ITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMEN
VKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNF
QFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER
IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY
Download sequence
Identical sequences I3DBW7 P05102
10mh_A 1hmy_A 1m0e_A 1mht_A 1skm_A 2c7o_A 2c7p_A 2c7q_A 2hmy_B 2hr1_A 3eeo_A 3mht_A 4mht_A 5ciy_A 5lod_A 5lod_B 5mht_A 6mht_A 7mht_A 8mht_A 9mht_A 2c7pA 000009369|e2c7pA1|2003.1.5.7|A:1-327 000099650|e8mhtA1|2003.1.5.7|A:1-327 000099652|e7mhtA1|2003.1.5.7|A:1-327 000099653|e10mhA1|2003.1.5.7|A:1-327 000099654|e6mhtA1|2003.1.5.7|A:1-327 000099655|e3mhtA1|2003.1.5.7|A:1-327 000099656|e2hmyB1|2003.1.5.7|B:1-327 000099657|e2hr1A1|2003.1.5.7|A:1-327 000099658|e1hmyA1|2003.1.5.7|A:1-327 000099659|e4mhtA1|2003.1.5.7|A:1-327 000099660|e2c7oA1|2003.1.5.7|A:1-327 000099661|e1mhtA1|2003.1.5.7|A:1-327 000099663|e2c7qA1|2003.1.5.7|A:1-327 000099664|e5mhtA1|2003.1.5.7|A:1-327 000099666|e9mhtA1|2003.1.5.7|A:1-327 000099667|e1m0eA1|2003.1.5.7|A:1-327 000099668|e1skmA1|2003.1.5.7|A:1-327 000138323|e3eeoA1|2003.1.5.7|A:1-327 001806834|e5ciyA1|2003.1.5.7|A:1-327 002101121|e5lodB1|2003.1.5.7|B:1-327 002101122|e5lodA1|2003.1.5.7|A:1-327 d10mha_ d1hmya_ d1m0ea_ d1mhta_ d1skma_ d2c7oa_ d2c7pa_ d2c7qa_ d2hmyb_ d2hr1a_ d3eeoa_ d3mhta_ d4mhta_ d5mhta_ d6mhta_ d7mhta_ d8mhta_ d9mhta_ WP_005706946.1.30626 WP_005706946.1.42619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]