SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fo7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fo7A
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.07e-75
Family Protein prenylyltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fo7A   PDB: 2fo7
Sequence length 136
Comment (A:)
Sequence
aeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyyqk
aleldprsaeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdyd
eaieyyqkaleldprs
Download sequence
Identical sequences 000159931|e2fo7A1|109.4.1.731|A:1-136 000336429|e2hyzA1|109.4.1.731|A:1-136 cath|current|2fo7A00/1-136 cath|current|2hyzA00/1-136 2fo7_A 2hyz_A 2fo7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]