SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ingX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ingX
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily BRCT domain 3.95e-28
Family BRCT domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 113-211
Classification Level Classification E-value
Superfamily BRCT domain 9.46e-25
Family BRCT domain 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ingX   PDB: 2ing
Sequence length 213
Comment (X:)
Sequence
gprmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflg
iaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrglei
ccygpftnkptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedngfhaigq
mceapvvtrewvldsvalyqcqeldtylipqip
Download sequence
Identical sequences 2ing_X 2ingX

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]