SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2nobA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nobA
Domain Number 1 Region: 134-320
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.1e-45
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000132
Further Details:      
 
Domain Number 2 Region: 10-133
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.1e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2nobA   PDB: 2nob
Sequence length 325
Comment (A:)
Sequence
amadigsefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladq
vwtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqe
vaqkfqgvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfp
slqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalci
lpgvgtqvadciclmaldkpqavpvdvamwhiaqrdyswhpttsqakgpspqtnkelgnf
frslwgpyagwaqavlfsadlrqsr
Download sequence
Identical sequences 2nobA 2nob_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]