SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2nu8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nu8A
Domain Number 1 Region: 122-283
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 3.44e-82
Family Succinyl-CoA synthetase domains 0.0000000469
Further Details:      
 
Domain Number 2 Region: 2-121
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.04e-43
Family CoA-binding domain 0.000000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2nu8A   PDB: 2nu8
Sequence length 288
Comment (A:)
Sequence
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
pntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
Download sequence
Identical sequences 2nu8_A 2nu8_D 2nu9_A 2nu9_D 2nu9_F 2nu9_H 2nu8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]