SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2odgC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2odgC
Domain Number 1 Region: 3-46
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000242
Family LEM domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2odgC   PDB: 2odg
Sequence length 47
Comment (C:)
Sequence
hdnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr
Download sequence
Identical sequences 2odc_I 2odg_C cath|current|2odcI00/1-47 cath|current|2odgC00/1-47 2odgC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]