SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_04398T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_04398T0
Domain Number 1 Region: 34-110,148-220
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.21e-23
Family Carboxylesterase/thioesterase 1 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPSG_04398T0
Sequence length 223
Comment | CPSG_04398 | Coccidioides posadasii Silveira conserved hypothetical protein (224 aa)
Sequence
MDRSSLKTFSPLKHLEGRIFHPCFLAGDGSFHPPDLQIQGLKESSQYVLGVIEREIELLG
GRSDNIIFGGLSQGMATALWTLLCSPGRVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKY
ASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQAC
QLLKEMGMDVKFYEYSRAENEGHWIKEPDGFDQIAAFLESKTS
Download sequence
Identical sequences E9D459
CPSG_04398T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]