SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_05803T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_05803T0
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000475
Family Carboxylesterase/thioesterase 1 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPSG_05803T0
Sequence length 263
Comment | CPSG_05803 | Coccidioides posadasii Silveira citrinin biosynthesis oxydoreductase CtnB (264 aa)
Sequence
MDARNQEYHRNTLHLPRILCLHGGGTNARIFKSQCRVVSRMLEPYFRFAYAEAPFDSMPG
PDVVSVYADYGPFKRWLPEHDEVEDRAGIEAINNSIKTAMIEDDRSGATGPWVGLLGFSQ
GAKLAASLIFRQQVRAEKLGRAKAGSDWKFAVLMAGRAPIVSLDPDVFRSSLLSNLSQTG
LSGPPELGDIMGEEHVLKLPTIHVHGLADPGLHLHRELLENYCSVDSARVVEWNGAHRVP
LKSADVNPLIEEILNLAKEIGAL
Download sequence
Identical sequences A0A0J6FD14 A0A0J6YAI1 C5PCB7 E9D7K1
CPSG_05803T0 CIRT_05387 CPAT_07350 XP_003067739.1.1890 222929.C5PCB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]