SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPSG_05987T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_05987T0
Domain Number 1 Region: 22-268
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.01e-20
Family Hydroxynitrile lyase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPSG_05987T0
Sequence length 271
Comment | CPSG_05987 | Coccidioides posadasii Silveira conserved hypothetical protein (272 aa)
Sequence
MSHGTTSGPVTQSGIDQMIRTKNPVIVMVPGAWHTPAAFDLLNPIFQKHNYDTWPIQLPS
VGISPGLPDMSADVAAVRSHVKKILDKDNRDVVIVMHSYSAVPATEAMKGLGKNERTESG
RQTGVVALLYIACLLPTEGRSSSDPGDVPQIKPVLRLKNHEDGTSTVKNPIEAFYHDVEP
SLAESSSKQLKAHSDGAFLTPLTHEAYRTIPSAYLLCKHDRAVPLAVQQYLADAAGIEIQ
ETLDSGHSPFLSQPHRVIDFVLRTLERFNIS
Download sequence
Identical sequences A0A0J6FCP9 C5PBY4 E9D835
XP_003067606.1.1890 CPSG_05987T0 CPAT_07160 222929.C5PBY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]