SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209546817|ref|YP_002278735.1| from Rhizobium leguminosarum bv. trifolii WSM2304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209546817|ref|YP_002278735.1|
Domain Number 1 Region: 146-337
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.13e-42
Family PHB depolymerase-like 0.07
Further Details:      
 
Domain Number 2 Region: 40-144
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.35e-18
Family PHB depolymerase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209546817|ref|YP_002278735.1|
Sequence length 343
Comment esterase, PHB depolymerase family [Rhizobium leguminosarum bv. trifolii WSM2304]
Sequence
MKFKFPKSLSQILKSQKRLRRILEKNLLQPSIGPKKARRPSAKIGLIEVKGFGSNPGRLF
MKLYAPSRMAAKLPLVVILHGCRQTPEGFDAASGFSALARQCGFVLLYPQQSEGNNPQRC
FNWFRPSAIARDRGELMSVRQMIEFTCDRHRIDRSRIYLAGLSAGGALTSALVATYPGLF
AGAAIFAGMPLGAARDAMSALRAMKSGVSRSPSEWGDLVRNVSPDQKAWPPISIWHGTDD
RVVNSSNARASVAQWLTVGGINEDAGQTTSKPWGELTQWKSKNKVQVSFYSLKGFGHGLP
VRRSAKEGQTARFDPYIVDASISGPLTLLRTWGLKKRPGQAPE
Download sequence
Identical sequences B6A061 I9NJ53
395492.Rleg2_4749 WP_003592131.1.20038 WP_003592131.1.84753 gi|209546817|ref|YP_002278735.1| gi|209546817|ref|YP_002278735.1|NC_011368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]