SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209547260|ref|YP_002279178.1| from Rhizobium leguminosarum bv. trifolii WSM2304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209547260|ref|YP_002279178.1|
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.83e-63
Family Epoxide hydrolase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|209547260|ref|YP_002279178.1|
Sequence length 287
Comment alpha/beta hydrolase fold protein [Rhizobium leguminosarum bv. trifolii WSM2304]
Sequence
MSFHGFELRMIDVDAGHIRVRVGGRGPPVLLLHGHPRTHMTWGRVADRLAPSFTVVCPDL
PGFGESYVPPDSSDSRHSSKDAKAAAMMELMNRLGHDEFFLVGHDRGSLTAFRMAMNHRR
AVRNLIVVDGLPVLEHLERADWKFARDWYHWFFFAQPDKPERVISADPEGWYDKLSPSLM
GEEAYEDIRAAIHRPETVHGMIEDYRAGIRIDHVHDRADRDAGRKVGCPMLCLWSLQDDL
EQIYGDPVAIWRNWAIDVRGYGIDSGHHVAEENPGDLAKAIVGFLSG
Download sequence
Identical sequences B6A1F4
gi|209547260|ref|YP_002279178.1| 395492.Rleg2_5248 WP_012556101.1.20038 gi|209547260|ref|YP_002279178.1|NC_011368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]