SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209549760|ref|YP_002281677.1| from Rhizobium leguminosarum bv. trifolii WSM2304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209549760|ref|YP_002281677.1|
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.37e-21
Family Carboxylesterase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|209549760|ref|YP_002281677.1|
Sequence length 242
Comment hypothetical protein Rleg2_2168 [Rhizobium leguminosarum bv. trifolii WSM2304]
Sequence
MNREYLRWYSQRLHRDMEMLVFGHAGAKVLVFPTREGRFFEYEQLGLVASLADKLQAGHL
QLYCIEGLATESLYGFHRHPADRIRRHAALEDYILNEVLPLMAAKNPHDCTIVHGCSLGA
FQAASLVFRHPHLFRKLVAFSGRYDLTMKVESFDDLFDGYYDDSVYFHTPTHFLPGLGSD
WRLDRLREIEIVLTIGDADPFLDNNRYLSRLLGEKNIRHQLHVWDGRAHRAGAWRRMAPL
YV
Download sequence
Identical sequences A0A0N1DK30 B5ZT48
395492.Rleg2_2168 gi|209549760|ref|YP_002281677.1| WP_012557996.1.20038 WP_012557996.1.46073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]