SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209552147|ref|YP_002284063.1| from Rhizobium leguminosarum bv. trifolii WSM2304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209552147|ref|YP_002284063.1|
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.01e-50
Family Haloperoxidase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|209552147|ref|YP_002284063.1|
Sequence length 266
Comment alpha/beta hydrolase fold [Rhizobium leguminosarum bv. trifolii WSM2304]
Sequence
MAKDQFLITSDNVQIFYDDEGDGQPIVFVHGYSSDAKYWHFQTSFFVANGFRVIALDQRL
HGRSGKPEYGQRMSRLGLDLYELIKSLDLKDVILVGHSMGANTCLSMFSLFGTDGISKFV
SIDQSPRLVNDSSWNWGIKNVYWERVWDQANFVQSFGEGRDPPRPVRVQELFGDGEDAFD
GFNHSVATTLLLNHLVSDWRDVLPFVNIPVWVITGRKTPYYHYEGMEWMANQFPQATITC
FEHSGHEPAWYEPEAFNEALLLFAKA
Download sequence
Identical sequences B6A5I8
gi|209552147|ref|YP_002284063.1|NC_011370 395492.Rleg2_6302 gi|209552147|ref|YP_002284063.1| WP_012559937.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]