SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003571354.1.13224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003571354.1.13224
Domain Number 1 Region: 41-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.76e-16
Family Bacterial lipase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003571354.1.13224
Sequence length 281
Comment MULTISPECIES: alpha/beta hydrolase [Lactobacillus casei group]; AA=GCF_000194785.1; RF=na; TAX=999378; STAX=1582; NAME=Lactobacillus casei LC2W; strain=LC2W; AL=Complete Genome; RT=Major
Sequence
MSGWFWIVAAIGLVVVVGGLADYLLLARPGYQPVPLVMDPVPTLFIPGHLGTRYSFGHML
WRLQRRYGLSKDVVAIVAPDGKVHLRGQLNLNHHAAVQVLFTDKAVRPAAQLHGLEKVIA
ALQTQQAFAEVNIVGHSMGGVTAVLYLLSKPTVPVANLVTIAAPMNDLEVAQRSPILNWR
LTRTGPEHAAPIYQQFQKTIGNLPANLRWLNIAGDLLIGGRHDGEVAINSSFAIRYLVKD
RIKDYTEVVIRGPRAAHSLLHENRLVDHDIVEYLWQRQRDF
Download sequence
Identical sequences A0A0B8TZ71 A0A0C9QBH6 A0A0E2M9P8 A0A125UAH6 A0A243PSI5 K0N7N2 K6PD30 K6QTZ9 K6RWH4 S2RZ88 S2U5X6
gi|409998090|ref|YP_006752491.1| 543734.LCABL_24710 gi|385820980|ref|YP_005857367.1| gi|532357616|ref|YP_008447450.1| gi|191639229|ref|YP_001988395.1| WP_003571354.1.13158 WP_003571354.1.13224 WP_003571354.1.20005 WP_003571354.1.2136 WP_003571354.1.22898 WP_003571354.1.24722 WP_003571354.1.25220 WP_003571354.1.26583 WP_003571354.1.29913 WP_003571354.1.33776 WP_003571354.1.35591 WP_003571354.1.39141 WP_003571354.1.39264 WP_003571354.1.40478 WP_003571354.1.44079 WP_003571354.1.44847 WP_003571354.1.45928 WP_003571354.1.46604 WP_003571354.1.49406 WP_003571354.1.505 WP_003571354.1.52467 WP_003571354.1.6012 WP_003571354.1.61849 WP_003571354.1.62572 WP_003571354.1.63838 WP_003571354.1.67564 WP_003571354.1.69447 WP_003571354.1.7166 WP_003571354.1.74597 WP_003571354.1.75061 WP_003571354.1.80634 WP_003571354.1.88086 WP_003571354.1.90364 WP_003571354.1.91063 WP_003571354.1.91737 WP_003571354.1.98897 gi|385824163|ref|YP_005860505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]