SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004669769.1.49700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004669769.1.49700
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.56e-24
Family Antibiotic resistance proteins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004669769.1.49700
Sequence length 119
Comment MULTISPECIES: glyoxalase/bleomycin resistance/extradiol dioxygenase family protein [Rhizobium]; AA=GCF_001664425.1; RF=na; TAX=396; STAX=396; NAME=Rhizobium phaseoli; strain=N841; AL=Complete Genome; RT=Major
Sequence
MADKSENHDRRIDYVEFNVADIAAAKAFYGSAFGWRFTDYGPNYCEFDDGRLKGGFTDFG
PVRPGGPLVVVYANDLEEVLTSVERAGGTICRPITDFPGGRRFHFLDRDGYELAVWATA
Download sequence
Identical sequences A0A060I1L3 A0A072CCU7 A0A0A8GDQ7 A0A0M3GHI3 A0A192LXM4 A0A192TCA6 A0A2A5L0U6 A0A2A6LJK4 A0A2A6R8W6 B3PQV2 F2A3D7
WP_004669769.1.100074 WP_004669769.1.10944 WP_004669769.1.12474 WP_004669769.1.19349 WP_004669769.1.22132 WP_004669769.1.25642 WP_004669769.1.26360 WP_004669769.1.27624 WP_004669769.1.27780 WP_004669769.1.2956 WP_004669769.1.35839 WP_004669769.1.36336 WP_004669769.1.37232 WP_004669769.1.39331 WP_004669769.1.47285 WP_004669769.1.49343 WP_004669769.1.49700 WP_004669769.1.61485 WP_004669769.1.76514 WP_004669769.1.79792 WP_004669769.1.79970 WP_004669769.1.81846 WP_004669769.1.82165 WP_004669769.1.84722 WP_004669769.1.88425 WP_004669769.1.9020 WP_004669769.1.9555 WP_004669769.1.96076 WP_004669769.1.964 WP_004669769.1.98140 gi|190892161|ref|YP_001978703.1| 491916.RHECIAT_CH0002573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]