SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007015978.1.54870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007015978.1.54870
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.53e-62
Family Carbon-carbon bond hydrolase 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007015978.1.54870
Sequence length 283
Comment MULTISPECIES: 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase [Sphingomonadales]; AA=GCF_000767465.1; RF=representative genome; TAX=1088721; STAX=205844; NAME=Novosphingobium pentaromativorans US6-1; strain=US6-1; AL=Complete Genome; RT=Major
Sequence
MTAVAIDIARPEIGKSVTVDGSVTNYHDVGDGAPVLLIHGSGPGVTAWANWRLNMPELAK
RFRVIAPDMFGFGYSDSKGRIEDKRVWVDQVASLLDGLGIDKVSMVGNSFGGGITLAFMI
AHPDRVERAVLMGPAGLDFPITPALDLVWGYQPSLEEMRASLKYLAWDHSRLTEDLVQSR
YEASARPEAHEPYYATFGGFDRQANIAMLASREEDVAALQHETLILHGLFDQVIPLDSTV
RLASLLPRADLHVFAECGHWVQIERMASFNRMVTEFFENGLNA
Download sequence
Identical sequences A0A031J7H4 A0A0G3XN58 G6EL51
gi|494073921|ref|WP_007015978.1|NZ_AGFM01000122 WP_007015978.1.54870 WP_007015978.1.63206 WP_007015978.1.71494 WP_007015978.1.95032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]