SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007166719.1.41218 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007166719.1.41218
Domain Number 1 Region: 24-209
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.19e-38
Family Cutinase-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007166719.1.41218
Sequence length 210
Comment cutinase family protein [Mycobacterium parascrofulaceum]; AA=GCF_000164135.1; RF=representative genome; TAX=525368; STAX=240125; NAME=Mycobacterium parascrofulaceum ATCC BAA-614; strain=ATCC BAA-614; AL=Scaffold; RT=Major
Sequence
MIGRRIVVGVAAALSSAAPAGPIGLPAAAADPCPAVEVVFARGTGQASGVGQVGQAFIDA
LGPQLSGRSMGVYAVNYPATTAFATSAQAGSDDTVAHVQDMIGRCPGTRLVLGGFSQGAG
VMDLATKALPPQAAGHVAAIAVFGNPTSPLANSLAGTVFPPIGPPYAAKTIDECADGDPA
CSGGGNVLAHGSYVQSGMTTQAANFVAARL
Download sequence
Identical sequences D5P9C9
WP_007166719.1.41218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]