SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009835611.1.13874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009835611.1.13874
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000461
Family Proline iminopeptidase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009835611.1.13874
Sequence length 192
Comment esterase [Marinomonas sp. MED121]; AA=GCF_000153025.1; RF=na; TAX=314277; STAX=314277; NAME=Marinomonas sp. MED121; strain=MED121; AL=Scaffold; RT=Major
Sequence
MPYLIYLHGFNSSENAHKASLLKQRCDALGLGESLIIPRLNWQPEKAIQQLEAIIESKLS
LGVTLFGSSLGGFYATYLAHKYQVKSVVLNPAVGAPVLLEKHLGVQKNYHTGEEYHLTEQ
HIHQLTAYDVALTRPDLFWLMLQKGDETLDYQHALDYYLGVNTLLEEGGNHSFEGFERYL
DQLICFAKLESN
Download sequence
Identical sequences A3Y8X2
WP_009835611.1.13874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]