SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010024265.1.96076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010024265.1.96076
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.62e-30
Family Antibiotic resistance proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010024265.1.96076
Sequence length 141
Comment MULTISPECIES: glyoxalase/bleomycin resistance/extradiol dioxygenase family protein [Rhizobium]; AA=GCF_001664385.1; RF=na; TAX=396; STAX=396; NAME=Rhizobium phaseoli; strain=R650; AL=Complete Genome; RT=Major
Sequence
MNPMLEGMLETALYARDLDKAEVFYEDVLGLEKISRAGNRHVFFRCGPGVLLIFNPEETV
KPPAPNALQVPPHGTSGEGHACFRVSGRNIDAMAERLKAAGVSIESEVHWPNGGRSIYFR
DPEGNSLECAEAKIWGIEQDI
Download sequence
Identical sequences A0A192T6F0 B3PZA1
WP_010024265.1.25642 WP_010024265.1.26360 WP_010024265.1.84722 WP_010024265.1.88425 WP_010024265.1.9020 WP_010024265.1.96076 gi|190890031|ref|YP_001976573.1| 491916.RHECIAT_CH0000401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]