SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010883196.1.24544 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010883196.1.24544
Sequence length 90
Comment small cysteine-rich outer membrane protein OmcA [Chlamydia pneumoniae]; AA=GCF_001007105.1; RF=na; TAX=83558; STAX=83558; NAME=Chlamydia pneumoniae; AL=Complete Genome; RT=Major
Sequence
MKKAVLIAAMFCGVVSLSSCCRIVDCCFEDPCAPSSCNPCEVIRKKERSCGGNACGSYVP
SCSNPCGSTECNSQSPQVKGCTSPDGRCKQ
Download sequence
Identical sequences A0A0F7X2C2 Q9Z7Z5
gi|15618469|ref|NP_224754.1| gi|33241911|ref|NP_876852.1| NP_224754.1.662 WP_010883196.1.100378 WP_010883196.1.15326 WP_010883196.1.24544 WP_010883196.1.35099 WP_010883196.1.46341 WP_010883196.1.48548 WP_010883196.1.81029 WP_010883196.1.8178 WP_010883196.1.91433 WP_010883196.1.95540 gi|15836089|ref|NP_300613.1| gi|16752482|ref|NP_444744.1| 115711.CP0193 115713.CPn0558 138677.CPj0558 182082.CpB0580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]