SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010967226.1.787 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010967226.1.787
Domain Number - Region: 3-138
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00575
Family Fungal lipases 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010967226.1.787
Sequence length 156
Comment hypothetical protein [Sinorhizobium meliloti]; AA=GCF_000346065.1; RF=na; TAX=1286640; STAX=382; NAME=Sinorhizobium meliloti 2011; strain=2011; AL=Complete Genome; RT=Major
Sequence
MTKVTVIAHSPGAPVSRRALLDAIRNQASWAGKTRLQLFAPAHIGAYLNKVRKELGIASR
LIASLTALTKFGVLSLDGLEPGSPFLTQLMEDSSKELANGWDAQVKARQVIFGDGENVVM
VQRFLEDPPHTVWPGHGHCSVCRCDKTAPAIASYLA
Download sequence
Identical sequences Q930G8
NP_435474.1.96377 WP_010967226.1.4234 WP_010967226.1.787 gi|16262681|ref|NP_435474.1| 266834.SMa0433 gi|16262681|ref|NP_435474.1|NC_003037 gi|470184215|ref|YP_007572188.1|NC_020527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]