SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010974329.1.57042 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010974329.1.57042
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.59e-64
Family Haloperoxidase 0.000000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010974329.1.57042
Sequence length 273
Comment MULTISPECIES: non-heme chloroperoxidase [Agrobacterium tumefaciens complex]; AA=GCF_000966435.1; RF=na; TAX=358; STAX=358; NAME=Agrobacterium tumefaciens; strain=F4; AL=Scaffold; RT=Major
Sequence
MSRFTTTDGTRLFYKDWGAGQPILFAHGWPLSSDAWDQQMLFFSQNGFRVIAHDRRSHGR
SDQTFDGNNMDQYADDLAELINALDLSDLILVGHSTGGGEVSHYVGRHGTARVAKVVLVG
AVPPVMLKTVDNPNGTPMEVFDSIRENTAKNRSQFFFDLTVPFYGFNREGVATNDGMREN
FRRIGLQGGVKGQYDCIREFSEVDYTRDLKSIDRPTLIIHGDDDQIVPIDASAHRAADLV
ADATLKIYSGGSHGLAETEADRFNADVLAFIHG
Download sequence
Identical sequences A0A083ZIH1 A0A1G9C537 A9CLQ9
NP_395999.1.86381 WP_010974329.1.11033 WP_010974329.1.51814 WP_010974329.1.57042 gi|16119293|ref|NP_395999.1| 176299.Atu5065 gi|16119293|ref|NP_395999.1|NC_003064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]