SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011558529.1.47369 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011558529.1.47369
Domain Number 1 Region: 38-222
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.49e-35
Family Cutinase-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011558529.1.47369
Sequence length 224
Comment MULTISPECIES: cutinase [Mycobacterium]; AA=GCF_000015405.1; RF=na; TAX=189918; STAX=189918; NAME=Mycobacterium sp. KMS; strain=KMS; AL=Complete Genome; RT=Major
Sequence
MPVISLRAGARLAATALSVVTAGVLVAAGPAPSATAQGCSDVELIFARGTSEPAGIGRVG
QALADAMRPILGGRTLSTYGVNYPATYDFLTTAAGAADATARIASVSSQCPGTRFVLGGY
SQGAAVIDMLAGVPPLGNRIGDIGSAPPLPGSYVSDVAAVTVFGNPATKFGNPVNARGLF
AGRGIDLCSDGDPICSDGRNPFAHTNYESSPFIGQAAGFAAGLI
Download sequence
Identical sequences A1UBY9
164756.Mmcs_1117 164757.Mjls_1146 189918.Mkms_1134 WP_011558529.1.20321 WP_011558529.1.3374 WP_011558529.1.44017 WP_011558529.1.47369 WP_011558529.1.73225 gi|108798089|ref|YP_638286.1| gi|119867185|ref|YP_937137.1| gi|126433749|ref|YP_001069440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]