SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012478069.1.16725 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012478069.1.16725
Domain Number 1 Region: 40-233
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000229
Family Carboxylesterase/thioesterase 1 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012478069.1.16725
Sequence length 247
Comment VirJ [Agrobacterium tumefaciens]; AA=GCF_001692265.1; RF=na; TAX=358; STAX=358; NAME=Agrobacterium tumefaciens; strain=15-1187-1-2a; AL=Scaffold; RT=Major
Sequence
MAIKLVLILVFTLFPAADAAYANDRANGFMWSNGGETGVRLPLRVFNAKPAKNTVAIIYS
GDAGWQNIDEAIGTYLQTEGIPVIGVSSLRYFWSERSPSETAKDLGHIIDVYTKHFGVQN
VLLVGYSFGADVMPASFNRLTLEQKNRVKQISLLALSHQVDYVVSFRGWLQLETEGKGGN
PLDDLRSIDPAIVQCMYGREDRNNACPSLRQTGAEVIGFSGGHHFDNDFKKLSTRVVSGL
VARLSHQ
Download sequence
Identical sequences A5WY48
WP_012478069.1.13542 WP_012478069.1.16725 WP_012478069.1.51814 WP_012478069.1.67129 WP_012478069.1.9167 gi|190014765|ref|YP_001967529.1|NC_010929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]