SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012482789.1.25642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012482789.1.25642
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.37e-19
Family Antibiotic resistance proteins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012482789.1.25642
Sequence length 127
Comment lactoylglutathione lyase [Rhizobium etli]; AA=GCF_000020265.1; RF=na; TAX=491916; STAX=29449; NAME=Rhizobium etli CIAT 652; strain=CIAT 652; AL=Complete Genome; RT=Major
Sequence
MLLYVTLGTNDLDRAGHFYDAVLPLLGYRRQHYSQEEIGYSADSDTRCRFWVVTPFNRRR
ATAGNGAMVAFTAETRAAVDAFHAAAIAEGAADEGGPGLRTYHAHFYAAYVRDLDGNKLS
AVCESPE
Download sequence
Identical sequences B3PQL5
WP_012482789.1.25642 gi|190890497|ref|YP_001977039.1| 491916.RHECIAT_CH0000876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]