SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012483482.1.96076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012483482.1.96076
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 8.46e-21
Family Antibiotic resistance proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012483482.1.96076
Sequence length 127
Comment MULTISPECIES: lactoylglutathione lyase [Rhizobium]; AA=GCF_001664385.1; RF=na; TAX=396; STAX=396; NAME=Rhizobium phaseoli; strain=R650; AL=Complete Genome; RT=Major
Sequence
MIDHITIAVSNLSNSKLFYEKAFLPLGYRLAFGKESVFWAFDIGNGCLFEIQQADSPPPL
TRVHVAFRACGKAEVDAFHHAALKAGARDNGAPGPRLEYAPDYYACFVLDPDGYNIEAMI
NQPAVGS
Download sequence
Identical sequences A0A192T946 B3PWU7
gi|190891381|ref|YP_001977923.1| WP_012483482.1.25642 WP_012483482.1.26360 WP_012483482.1.84722 WP_012483482.1.88425 WP_012483482.1.9020 WP_012483482.1.96076 491916.RHECIAT_CH0001775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]