SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012483889.1.96076 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012483889.1.96076
Domain Number 1 Region: 101-284
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.49e-19
Family Cutinase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012483889.1.96076
Sequence length 299
Comment MULTISPECIES: phospholipase [Rhizobium]; AA=GCF_001664385.1; RF=na; TAX=396; STAX=396; NAME=Rhizobium phaseoli; strain=R650; AL=Complete Genome; RT=Major
Sequence
MRMSTSDCTVISAIAAFFLSAAMLSSGGPAQAAGALAPFKDELFSKQTVLQTGDDGAFEV
VDYDEMRDINGRDQVPQKRVQQKYVALGIRKAQVDETLSLDGISLDVTRVGPAQNAAFTV
IFIHGRDGDRRLGANDYSFGGNFNRLKNLAAGNGGVYYSPTVKSFDSNGVAAIAGLIRYA
SAQSPGRPVILSCASMGSQVCWGIARDEASVQRLKGMLIMSGVTDPDFTRSAFYKAKLPL
WFAHGSRDPVYAASDQQALFEKLHNAKYPARFTLFQTGNHGTPIRMVDWRRVLNWILAT
Download sequence
Identical sequences B3Q0M5
491916.RHECIAT_CH0002274 gi|190891865|ref|YP_001978407.1| WP_012483889.1.19349 WP_012483889.1.25642 WP_012483889.1.26360 WP_012483889.1.84722 WP_012483889.1.88425 WP_012483889.1.9020 WP_012483889.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]