SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012484194.1.25642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012484194.1.25642
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.1e-21
Family Carboxylesterase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012484194.1.25642
Sequence length 242
Comment esterase [Rhizobium etli]; AA=GCF_000020265.1; RF=na; TAX=491916; STAX=29449; NAME=Rhizobium etli CIAT 652; strain=CIAT 652; AL=Complete Genome; RT=Major
Sequence
MNREYLRWYSQRLHRDMEMLVFGHAGAKVLVFPTREGRFFEYEQLGLVASLAEKLQAGHL
QLYCIEGLAADSLYGFHHHPAERIRRHAALEDYILHEVLPLMAAKNPHDCTIVHGCSLGA
FQAASLVFRHPHLFRKLVAFSGRYDLTMKVESFGDLFDGYYDDSVYFHTPTHFLPGLGAD
WRLDRLRQIDIVLTIGEADPFLDNNRYFSRLLGEKNIRHQLHLWDGRAHRAGAWRKMAAL
YI
Download sequence
Identical sequences B3PRN4
WP_012484194.1.25642 491916.RHECIAT_CH0002642 gi|190892230|ref|YP_001978772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]