SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012557909.1.20038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012557909.1.20038
Domain Number 1 Region: 22-119,148-245
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.53e-24
Family Hydroxynitrile lyase-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012557909.1.20038
Sequence length 252
Comment alpha/beta hydrolase [Rhizobium leguminosarum]; AA=GCF_000021345.1; RF=representative genome; TAX=395492; STAX=384; NAME=Rhizobium leguminosarum bv. trifolii WSM2304; strain=WSM2304; AL=Complete Genome; RT=Major
Sequence
MNRRLLFTAALAFATAAIAFAAEAAAVKNIVIVHGALADGSGWRKATEILQKRGFNVTIV
QEPITSLDDDVAATKRVLDLQDGPSLLVGHSYGGMVITEAGNDPNVAGLVYVAAFQPDKG
ESLLSLASSKPAGSMDIKETKDGKYLYLDPAAFAADFAADLPQAEADFLARSQVFASKQA
FSAKIAEPAWRTKPSWSIVVTEDRAINPELERDMAKRAGSEVTEIKASHAVFASQAEKVA
DIIEKAARKAGE
Download sequence
Identical sequences B5ZS97
gi|209549647|ref|YP_002281564.1| 395492.Rleg2_2054 WP_012557909.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]