SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013483420.1.63498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013483420.1.63498
Domain Number 1 Region: 11-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.05e-28
Family Haloalkane dehalogenase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013483420.1.63498
Sequence length 277
Comment hypothetical protein [Ruminococcus albus]; AA=GCF_000621285.1; RF=na; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=DSM 20455; AL=Scaffold; RT=Major
Sequence
MKAKFRKDLEFVKINGHKLHIFRCGDANKPKLVFMSGSGTVAPIYDFKVLYKKLLDDYRI
IVIEKFGYGYSDLYECPCDIDSVVSYQKQALKMIGEKAPYILLPHSMSGIEAIRWKQMYP
DDIKAIIGLDMATPLTYMEWGNKEIHKRLELMRRLKKLNNLGLMFWYPISKRELNKDEIQ
QHNLLKRRNLMNNCYVNEAMQVLKNAKIVARAGKAECPTLMFVSDGKQTSPNWISNEQKY
AKSVNAETVFLNCGHYIHYYESDKISSKIKAFLSKLA
Download sequence
Identical sequences E6UJM4
gi|317133845|ref|YP_004089756.1| gi|317133845|ref|YP_004089756.1|NC_014824 WP_013483420.1.49193 WP_013483420.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]