SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013610235.1.85604 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013610235.1.85604
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.23e-45
Family Carbon-carbon bond hydrolase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013610235.1.85604
Sequence length 272
Comment VALACYCLOVIR HYDROLASE [Vibrio nigripulchritudo]; AA=GCF_001050715.1; RF=na; TAX=1238448; STAX=28173; NAME=Vibrio nigripulchritudo SFn135; strain=SFn135; AL=Contig; RT=Major
Sequence
MSIYNHFNKVHYHTWGNRSHQAIILIHGIDNNLCIWDEIADGLAKYFYVVAIDIRGNGNS
PWNSSAHYTEEDVYTDIRHVINELLITSAVLVGHSLGGKLSLCFTARSPNIIEKLVLLDS
SPVLSKSMQAVLLNYINEQPTSFSSIEDYVDYLTRTHAFSDRNKLEVFASTNVKLSDGRY
EKKSDPAFALSMLSDDGFLLDSEVWRVMSELTCPVLIVRGKLSSITKYSEAERMLRSFRH
ASLIEVGNASHSIMLDQPKKVLDSILGFIMLS
Download sequence
Identical sequences F0V0Z2
gi|326326001|ref|YP_004250810.1|NC_015156 WP_013610235.1.100974 WP_013610235.1.79392 WP_013610235.1.83433 WP_013610235.1.85604 WP_013610235.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]