SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014031032.1.92869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014031032.1.92869
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.79e-29
Family Hydroxynitrile lyase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014031032.1.92869
Sequence length 238
Comment MULTISPECIES: esterase [Haloarcula]; AA=GCF_000827835.1; RF=na; TAX=1592728; STAX=1592728; NAME=Haloarcula sp. CBA1115; strain=CBA1115; AL=Complete Genome; RT=Major
Sequence
MEQQFVLVPGAWLGGWCWKYLHPLLREEGHEVYTPTLTGLGEREHLSHCEVDLETHITDI
VNVLEYNDLTDVVLLGHSYAGLVVTGVAERVPERLKHMVYLDALIPMNDDPVSAAEFYPL
DEWKTMEAAAEDHAGGWPLPDDHSGWVGISDEDTEWMREKAVPHPLDTFRQQVNVGTPDV
SLPTSYILCTQSGMDGSTLDMIRQLCEQREWQLGELDTGHWPMVSIPQQLSHQLLEVH
Download sequence
Identical sequences A0A0B5GZ99 G0HZV0 V5TSV5
WP_014031032.1.27393 WP_014031032.1.67629 WP_014031032.1.92404 WP_014031032.1.92869 gi|564287994|ref|YP_008874186.1| gi|344209979|ref|YP_004786155.1|NC_015944 gi|564287994|ref|YP_008874186.1|NC_023012 gi|344209979|ref|YP_004786155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]