SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014360471.1.98463 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014360471.1.98463
Domain Number 1 Region: 4-254
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.36e-33
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014360471.1.98463
Sequence length 256
Comment alpha/beta hydrolase [Gordonia polyisoprenivorans]; AA=GCF_000247715.1; RF=representative genome; TAX=1112204; STAX=84595; NAME=Gordonia polyisoprenivorans VH2; strain=VH2; AL=Complete Genome; RT=Major
Sequence
MHRTAIAYGGANSQFGHIYHAAEEADLPATMRPIVLIHGGYWTTEFSLTIESAIARQYGE
RGALVWNIEYRRVGEDGGGWPHTGRDVVAAINALDGPVREALPAPVADRVDWNSVAVVGH
SAGGQLAVWATAQLRAQTANTRITTVVAQSAALDLVAAGQAGRESVQALIGRPYAQAAQR
YRAASPMEQDPFDAHVVVIHGDRDTAIPVELSRRYVSTVCARGQSAELIVVPEEGHDAFV
DPRSVCNRQTIRALGL
Download sequence
Identical sequences H6MTS4
WP_014360471.1.98463 gi|378718426|ref|YP_005283315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]