SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014381076.1.3602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014381076.1.3602
Domain Number 1 Region: 30-221
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.53e-36
Family Cutinase-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014381076.1.3602
Sequence length 293
Comment cutinase [Mycobacterium intracellulare]; AA=GCF_000277125.1; RF=representative genome; TAX=487521; STAX=1767; NAME=Mycobacterium intracellulare ATCC 13950; strain=ATCC 13950; AL=Complete Genome; RT=Major
Sequence
MKTHRAARLVGLGASALVTAAGLLAAPAATPVASADDCPDVEVIFARGTNEPPGLGRVGD
AFVDSLRQQTGGLNILPYGVNYAASKLQLHGGDGANDTIDRVKKSVEKCPSTKIVLGGYS
QGASVMDIVAGVPIGGINWGNSLPPQYADNIAAVATFGDVADRAGGTLPSQSKLLGSKAI
DLCNPNDPICHAGPGNEWSGHTEGYVPVYTTQAAAFVASKLVGTGQSVPGYGPSFPGAGP
QVPGQPGYGQQTPVYGQTPPGSGPSIHGGTGTAPAPAPLAPGPVTSVPQAPLV
Download sequence
Identical sequences A0A249BTQ5 H8IQS3
WP_014381076.1.33860 WP_014381076.1.3602 WP_014381076.1.37776 WP_014381076.1.69645 WP_014381076.1.92968 gi|379748979|ref|YP_005339800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]