SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014747971.1.78709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014747971.1.78709
Domain Number 1 Region: 13-218
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000174
Family Dienelactone hydrolase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014747971.1.78709
Sequence length 270
Comment dienelactone hydrolase [Tistrella mobilis]; AA=GCF_000264455.2; RF=representative genome; TAX=1110502; STAX=171437; NAME=Tistrella mobilis KA081020-065; strain=KA081020-065; AL=Complete Genome; RT=Major
Sequence
MHALDQDDDLADFEPREITIDDVTRRVRVAGQGPGVIVMTEMPGISPEVARFARWVRDAG
FTVWMPSLFGRDGAVPEADEGAAIFRRTCIAATFRAVATGGPGAVTAWLRGLARIAHQAC
GGPGVGAIGMCFTGNYALSMMLEPAVLAPVLCQPSLPLDAPAAIESPPEELAAVRARLDR
ENLTVLAYRFAGDAVCRAERFAAYERALGNRFQPRTLPDTAARREGLSPFFARHVPTPHS
VVTAHLIDEAGQPTLAARDEILAFFADRLA
Download sequence
Identical sequences I3TW44
gi|389874608|ref|YP_006373964.1| WP_014747971.1.78709 gi|389874608|ref|YP_006373964.1|NC_017958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]