SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020919570.1.76939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020919570.1.76939
Domain Number 1 Region: 21-254
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.16e-37
Family Carboxylesterase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020919570.1.76939
Sequence length 282
Comment alpha/beta hydrolase [Rhizobium etli]; AA=GCF_000442435.1; RF=na; TAX=1328306; STAX=29449; NAME=Rhizobium etli bv. mimosae str. Mim1; strain=Mim1; AL=Complete Genome; RT=Major
Sequence
MAVDPFRTRDHVTDFDEIVDDIRARSLATRRTVTMESNIAYGTGPDETLDIFLPSNAGSD
MPIHMFVHGGYWRMFSKEDYSCVAETITGVGAVAAIVDYSLMPAVRMDVLVGQVLKAKAF
LLAHANRFGATRKQFSVSGHSAGAHLATFLFHRSPAPSGVVAAFLLGGLYDLEPLQTSFL
REEIALSDEEVLRFTPMRHEHDPATRVAIMTGELETDPFRRQANAFRKILAAQGLEVRES
LVADGNHMSTVRDLAVAGTPVAAALRAAIVDAGARSERSAYP
Download sequence
Identical sequences S5SWG2
gi|528838061|ref|YP_008369141.1| WP_020919570.1.76939 gi|528838061|ref|YP_008369141.1|NC_021911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]