SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001904431.1.27508 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001904431.1.27508
Domain Number 1 Region: 12-55,105-171
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.84e-18
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001904431.1.27508
Sequence length 196
Comment hypothetical protein [Podospora anserina S mat+]; AA=GCF_000226545.1; RF=representative genome; TAX=515849; STAX=5145; NAME=Podospora anserina S mat+; AL=Scaffold; RT=Major
Sequence
MSSLFSYISTALPTVNSSNVIIWGFSTGGYYSLRAAHTHPSHLLGSVSLGGGCHHMFDET
WLRNVNHLEYPFDLAHTLAHKFGYGDNLDQFIKEGKSKFSLLDSGILDQESCKTLVVNGD
LDEIFPVEDLYLAVKDKNGNVRKNTEFKVVEGRKHMGEPESFGVILEWIHGLWGLKAGVD
EFKKGVLEGLPFKPKY
Download sequence
Identical sequences B2AFJ2
XP_001904431.1.27508 Pa_5_11770|chrm5_SC7|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]