SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002844832.1.42340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002844832.1.42340
Domain Number - Region: 72-122
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0017
Family Methylesterase CheB, C-terminal domain 0.0091
Further Details:      
 
Domain Number - Region: 128-295
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00173
Family Atu1826-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002844832.1.42340
Sequence length 302
Comment PaxU [Arthroderma otae CBS 113480]; AA=GCF_000151145.1; RF=representative genome; TAX=554155; STAX=63405; NAME=Arthroderma otae CBS 113480; strain=CBS 113480; AL=Scaffold; RT=Major
Sequence
MAPPLEKLPPLIDSSFVKIGPSIWLRDFPNPSDRAESDEVAQLAVTASSRLTIVILFWMD
ARLRYANKYISEYTKLAPNARILFVLTSSADLFLKTSEAAQTRRVQPAVDVLLFSAAPAT
SPGLSSNDQLYLHLFSNGGSVTLRSIALAYQKVTKKPLPLNSLIMDSCPGKSTFSGAYRA
VSYGLPKSSLPRFFAGMAVWVALLLAFTYYRVFRREFPAELAWKASIDPELIDSRVKRCY
IYSELDDLISWKGVEEHSYEAESKGYRVIREKFHGSPHVGHMRHDYRRYWGIVTYYLKIA
VE
Download sequence
Identical sequences C5FVP3
XP_002844832.1.42340 MCYG_06796T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]