SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_1_15270|chrm1_SC4|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_15270|chrm1_SC4|Putative
Domain Number 1 Region: 40-223
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.78e-42
Family Cutinase-like 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pa_1_15270|chrm1_SC4|Putative
Sequence length 225
Comment Carbohydrate Esterase Family 5
Sequence
MQFLTTVLALAGAVAALPVEQKTEIVEARQLFGSDTKNELINGGACPPVIFIYARGSTER
GNLGTLGPSVGDALKDRFGSANVWVQGVGGAYTADLLDNALPDGTTRAAIAEMKGLLTLA
HTKCPSAKVVAGGYSQGAALAAASISTSTAAIREQIKGVVLFGYTKNLQNLGRIPDYPRE
RTEVYCATGDLVCTGTLIVTAAHLTYGDEARNEAPRFLIARINAS
Download sequence
Identical sequences B2ATB3
Pa_1_15270|chrm1_SC4|Putative XP_001906965.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]