SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_5_11770|chrm5_SC7|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_5_11770|chrm5_SC7|Putative
Domain Number 1 Region: 12-55,105-171
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.84e-18
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pa_5_11770|chrm5_SC7|Putative
Sequence length 196
Comment protein of unknown function
Sequence
MSSLFSYISTALPTVNSSNVIIWGFSTGGYYSLRAAHTHPSHLLGSVSLGGGCHHMFDET
WLRNVNHLEYPFDLAHTLAHKFGYGDNLDQFIKEGKSKFSLLDSGILDQESCKTLVVNGD
LDEIFPVEDLYLAVKDKNGNVRKNTEFKVVEGRKHMGEPESFGVILEWIHGLWGLKAGVD
EFKKGVLEGLPFKPKY
Download sequence
Identical sequences B2AFJ2
Pa_5_11770|chrm5_SC7|Putative XP_001904431.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]