SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fp4_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fp4_A
Domain Number 1 Region: 10-296
Classification Level Classification E-value
Superfamily PDB 1.13e-91
Family PDB 0.0051
Further Details:      
 
Domain Number 2 Region: 130-294
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 7.32e-81
Family Succinyl-CoA synthetase domains 0.0000000425
Further Details:      
 
Domain Number 3 Region: 27-137
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.64e-47
Family CoA-binding domain 0.000000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2fp4_A
Sequence length 305
Comment mol:protein length:305 Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
Sequence
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
krkml
Download sequence
Identical sequences 2fp4A 2fp4_A 2fpg_A 2fpi_A 2fpp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]